This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
UBE2D3 monoclonal antibody (M03), clone S2
catalog :
H00007323-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
S2
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00007323-M03
product name :
UBE2D3 monoclonal antibody (M03), clone S2
product description :
Mouse monoclonal antibody raised against a full-length recombinant UBE2D3.
clone name :
S2
isotype :
IgG1 Kappa
gene name :
UBE2D3
gene alias :
E2(17)KB3 MGC43926 MGC5416 UBC4/5 UBCH5C
gene description :
ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
genbank accession :
BC003395
immunogen :
UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMG
PNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI
NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD
PLVPEIARIYKTDRDKYNRISREWTQKYAM
PNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNI
NSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDD
PLVPEIARIYKTDRDKYNRISREWTQKYAM
protein accession :
AAH03395
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2008-04-24
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
