product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
TXN monoclonal antibody (M01), clone 2A7
catalog :
H00007295-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A7
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunoprecipitation
more info or order :
citations: 1
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
|
product information
catalog id :
H00007295-M01
product name :
TXN monoclonal antibody (M01), clone 2A7
product description :
Mouse monoclonal antibody raised against a full length recombinant TXN.
clone name :
2A7
isotype :
IgG1 Kappa
gene name :
TXN
gene alias :
DKFZp686B1993 MGC61975 TRX TRX1
gene description :
thioredoxin
genbank accession :
BC003377
immunogen :
TXN (AAH03377, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIK
PFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQ
FFKKGQKVGEFSGANKEKLEATINELV
PFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQ
FFKKGQKVGEFSGANKEKLEATINELV
protein accession :
AAH03377
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- TXN monoclonal antibody (M04), clone 6C10 | H00007295-M04
- TXNRD1 purified MaxPab mouse polyclonal antibody (B01P) | H00007296-B01P
- TXNRD1 purified MaxPab rabbit polyclonal antibody (D01P) | H00007296-D01P
- TYK2 purified MaxPab rabbit polyclonal antibody (D01P) | H00007297-D01P
- TYK2 monoclonal antibody (M01), clone 6G12 | H00007297-M01
questions and comments
