This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
TNFRSF1A (Human) Recombinant Protein
catalog :
H00007132-H02
quantity :
2 ug
product information
catalog id :
H00007132-H02
product name :
TNFRSF1A (Human) Recombinant Protein
product description :
Purified TNFRSF1A (AAH10140.1 22 a.a. - 211 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
gene name :
TNFRSF1A
gene alias :
CD120a FPF MGC19588 TBP1 TNF-R TNF-R-I TNF-R55 TNFAR TNFR1 TNFR55 TNFR60 p55 p55-R p60
gene description :
tumor necrosis factor receptor superfamily, member 1A
genbank accession :
BC010140.1
immunogen sequence protein sequence :
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHC
LSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSE
NLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLREN
ECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHC
LSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSE
NLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLREN
ECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
protein accession :
AAH10140.1
form :
Liquid
concentration :
10 ug/ml
host cell :
Human HEK293H cells
preparation method :
Transfection of pSuper-TNFRSF1A plasmid into HEK293H cell, and the expressed protein was purified by Strep -Tactin affinity column.
storage buffer :
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
SDS-PAGE and Western Blot
tag :
His-Flag-StrepII
type clonality :
Protein
raised in host species :
Human
antigen species target species :
Human
application key :
WB,ELISA,SDS-PAGE,PI
size :
2 ug
autodate :
2015-10-13
updatetime :
2015-10-13 09:45:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
