This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TSPAN8 monoclonal antibody (M02), clone 1E5
catalog :
H00007103-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1.00E+05
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
citations: 1
product information
catalog id :
H00007103-M02
product name :
TSPAN8 monoclonal antibody (M02), clone 1E5
product description :
Mouse monoclonal antibody raised against a partial recombinant TSPAN8.
clone name :
1.00E+05
isotype :
IgG3 Lambda
gene name :
TSPAN8
gene alias :
CO-029 TM4SF3
gene description :
tetraspanin 8
genbank accession :
NM_004616
immunogen :
TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEE
FKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGK
QVYKETCISFIKDFLAKN
FKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGK
QVYKETCISFIKDFLAKN
protein accession :
NP_004607
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,WB-Tr,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
