This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TLR5 monoclonal antibody (M10), clone 4D12
catalog :
H00007100-M10
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4D12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00007100-M10
product name :
TLR5 monoclonal antibody (M10), clone 4D12
product description :
Mouse monoclonal antibody raised against a full length recombinant TLR5.
clone name :
4D12
isotype :
IgG2a Kappa
gene name :
TLR5
gene alias :
FLJ10052 MGC126430 MGC126431 SLEB1 TIL3
gene description :
toll-like receptor 5
genbank accession :
NM_003268
immunogen :
TLR5 (NP_003259.2, 351 a.a. ~ 450 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTL
DLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLI
HLSENRLENLDILYFLLRVPHL
DLRDNALTTIHFIPSIPDIFLSGNKLVTLPKINLTANLI
HLSENRLENLDILYFLLRVPHL
protein accession :
NP_003259.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA
size :
100 ug
autodate :
2007-10-29
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
