This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TIE1 monoclonal antibody (M20), clone 1G10
catalog :
H00007075-M20
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00007075-M20
product name :
TIE1 monoclonal antibody (M20), clone 1G10
product description :
Mouse monoclonal antibody raised against a full length recombinant TIE1.
clone name :
1G10
isotype :
IgG2a Kappa
gene name :
TIE1
gene alias :
JTK14 TIE
gene description :
tyrosine kinase with immunoglobulin-like and EGF-like domains 1
genbank accession :
NM_005424
immunogen :
TIE1 (NP_005415, 536 a.a. ~ 643 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
TLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGP
LVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPG
THYQLDVQLYHCTLLGPASPPAHVLLPPSG*
LVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPG
THYQLDVQLYHCTLLGPASPPAHVLLPPSG*
protein accession :
NP_005415
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
100 ug
autodate :
2007-10-29
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
