This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TFPI monoclonal antibody (M01), clone 2E5
catalog :
H00007035-M01
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2E5
reactivity :
human
product information
catalog id :
H00007035-M01
product name :
TFPI monoclonal antibody (M01), clone 2E5
product description :
Mouse monoclonal antibody raised against a full-length recombinant TFPI.
clone name :
2E5
isotype :
IgG2a Kappa
gene name :
TFPI
gene alias :
EPI LACI TFI TFPI1
gene description :
tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
genbank accession :
BC015514
immunogen :
TFPI (AAH15514, 1 a.a. ~ 251 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTII
TDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQ
CEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTL
QQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYG
GCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVN
NSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFC
IHASMFFLGLDSISCLC
TDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQ
CEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTL
QQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYG
GCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVN
NSLTPQSTKVPSLFVTKEGTNDGWKNAAHIYQVFLNAFC
IHASMFFLGLDSISCLC
protein accession :
AAH15514
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
50 ug
autodate :
2010-08-30
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
