product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
TFF3 monoclonal antibody (M01), clone 3D9
catalog :
H00007033-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3D9
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
more info or order :
citations: 7
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
product information
catalog id :
H00007033-M01
product name :
TFF3 monoclonal antibody (M01), clone 3D9
product description :
Mouse monoclonal antibody raised against a full length recombinant TFF3.
clone name :
3D9
isotype :
IgG1 Kappa
gene name :
TFF3
gene alias :
HITF ITF TFI hP1.B
gene description :
trefoil factor 3 (intestinal)
genbank accession :
BC017859
immunogen :
TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFD
SRIPGVPWCFKPLQEAECTF
SRIPGVPWCFKPLQEAECTF
protein accession :
AAH17859.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,IHC-P
size :
100 ug
autodate :
11/2/06
updatetime :
11/15/13 18:37
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
questions and comments
