This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TEAD4 monoclonal antibody (M01A), clone 5H3
catalog :
H00007004-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5H3
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00007004-M01A
product name :
TEAD4 monoclonal antibody (M01A), clone 5H3
product description :
Mouse monoclonal antibody raised against a partial recombinant TEAD4.
clone name :
5H3
isotype :
IgG2a Kappa
gene name :
TEAD4
gene alias :
EFTR-2 MGC9014 RTEF1 TCF13L1 TEF-3 TEFR-1 hRTEF-1B
gene description :
TEA domain family member 4
genbank accession :
NM_003213
immunogen :
TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQP
PLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLE
FSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
PLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLE
FSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP
protein accession :
NP_003204
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re,WB-Tr
size :
200 uL
autodate :
2010-09-20
updatetime :
2012-01-13 16:42:47
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
