This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PRDX2 purified MaxPab mouse polyclonal antibody (B02P)
catalog :
H00007001-B02P
quantity :
50 ug
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00007001-B02P
product name :
PRDX2 purified MaxPab mouse polyclonal antibody (B02P)
product description :
Mouse polyclonal antibody raised against a full-length human PRDX2 protein.
gene name :
PRDX2
gene alias :
MGC4104 NKEFB PRP PRX2 PRXII TDPX1 TSA
gene description :
peroxiredoxin 2
genbank accession :
NM_005809.4
immunogen :
PRDX2 (NP_005800.3, 1 a.a. ~ 198 a.a) full-length human protein.
immunogen sequence protein sequence :
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVV
LFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVD
SQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGV
LKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEAL
RLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFS
KHN
LFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVD
SQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGV
LKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEAL
RLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFS
KHN
protein accession :
NP_005800.3
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,WB-Tr
size :
50 ug
autodate :
2009-09-28
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
