This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
TBX3 monoclonal antibody (M02), clone 8H3
catalog :
H00006926-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
8H3
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00006926-M02
product name :
TBX3 monoclonal antibody (M02), clone 8H3
product description :
Mouse monoclonal antibody raised against a partial recombinant TBX3.
clone name :
8H3
isotype :
IgG2a Kappa
gene name :
TBX3
gene alias :
TBX3-ISO UMS XHL
gene description :
T-box 3
genbank accession :
NM_005996
immunogen :
TBX3 (NP_005987, 311 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLC
PSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKG
SPAVKAHLFAAERPRDSGRLDK
PSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKG
SPAVKAHLFAAERPRDSGRLDK
protein accession :
NP_005987
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Re,ELISA,S-ELISA,WB-Ce,IF
size :
100 ug
autodate :
4/16/15
updatetime :
4/16/15 15:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
