This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SUPT5H monoclonal antibody (M02), clone 5C8
catalog :
H00006829-M02
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5C8
reactivity :
human, rat
application :
western blot, ELISA
product information
catalog id :
H00006829-M02
product name :
SUPT5H monoclonal antibody (M02), clone 5C8
product description :
Mouse monoclonal antibody raised against a partial recombinant SUPT5H.
clone name :
5C8
isotype :
IgG2b Kappa
gene name :
SUPT5H
gene alias :
FLJ34157 SPT5 SPT5H
gene description :
suppressor of Ty 5 homolog (S. cerevisiae)
genbank accession :
BC024203
immunogen :
SUPT5H (AAH24203, 981 a.a. ~ 1087 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
TTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDS
EKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSI
DGEDGIVRMDLDEQLKILNLRFLGKLLEA
EKVVSISSEHLEPITPTKNNKVKVILGEDREATGVLLSI
DGEDGIVRMDLDEQLKILNLRFLGKLLEA
protein accession :
AAH24203
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
50 ug
autodate :
2008-05-14
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
