This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SUPT4H1 monoclonal antibody (M01), clone 3G4
catalog :
H00006827-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3G4
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00006827-M01
product name :
SUPT4H1 monoclonal antibody (M01), clone 3G4
product description :
Mouse monoclonal antibody raised against a partial recombinant SUPT4H1.
clone name :
3G4
isotype :
IgG2a Kappa
gene name :
SUPT4H1
gene alias :
SPT4 SPT4H SUPT4H
gene description :
suppressor of Ty 4 homolog 1 (S. cerevisiae)
genbank accession :
NM_003168
immunogen :
SUPT4H1 (NP_003159, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSS
FDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQ
GIVRELKSRGVAYKSRDTAIKT
protein accession :
NP_003159
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2010-09-06
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098