This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SULT1A3 monoclonal antibody (M01), clone 1B10
catalog :
H00006818-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00006818-M01
product name :
SULT1A3 monoclonal antibody (M01), clone 1B10
product description :
Mouse monoclonal antibody raised against a full-length recombinant SULT1A3.
clone name :
1B10
isotype :
IgG2a Kappa
gene name :
SULT1A3
gene alias :
HAST HAST3 M-PST MGC117469 ST1A5 STM SULT1A4 TL-PST
gene description :
sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3
genbank accession :
BC014471
immunogen :
SULT1A3 (AAH14471, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPD
DLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVR
VPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQT
LLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWD
SFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYED
MKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKK
NPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQN
ERFDADYAEKMAGCSLSFRSEL
DLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVR
VPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQT
LLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWD
SFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYED
MKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKK
NPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQN
ERFDADYAEKMAGCSLSFRSEL
protein accession :
AAH14471
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2012-12-11
updatetime :
2013-11-15 18:50:26
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
