STIM1 monoclonal antibody (M01), clone 5A2 | Abnova H00006786-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

STIM1 monoclonal antibody (M01), clone 5A2

catalog :

H00006786-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

5A2

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Abnova product webpage

citations: 17

Published Application/Species/Sample/Dilution	Reference
western blot; mouse; loading ...; fig 3c	Lisak D, Schacht T, Gawlitza A, Albrecht P, Aktas O, Koop B, et al. BAX inhibitor-1 is a Ca(2+) channel critically important for immune cell function and survival. Cell Death Differ. 2016;23:358-68 pubmed publisher
immunohistochemistry; human; 1:75	Steinbeck J, Henke N, Opatz J, Gruszczynska Biegala J, Schneider L, Theiss S, et al. Store-operated calcium entry modulates neuronal network activity in a model of chronic epilepsy. Exp Neurol. 2011;232:185-94 pubmed publisher
western blot; mouse western blot; human	Schuhmann M, Stegner D, Berna Erro A, Bittner S, Braun A, Kleinschnitz C, et al. Stromal interaction molecules 1 and 2 are key regulators of autoreactive T cell activation in murine autoimmune central nervous system inflammation. J Immunol. 2010;184:1536-42 pubmed publisher
	Henke N, Albrecht P, Pfeiffer A, Toutzaris D, Zanger K, Methner A. Stromal interaction molecule 1 (STIM1) is involved in the regulation of mitochondrial shape and bioenergetics and plays a role in oxidative stress. J Biol Chem. 2012;287:42042-52 pubmed publisher
	Halloran S, Launoy G, Zappa M. European guidelines for quality assurance in colorectal cancer screening and diagnosis. First Edition--Faecal occult blood testing. Endoscopy. 2012;44 Suppl 3:SE65-87 pubmed
	Elvers M, Herrmann A, Seizer P, Münzer P, Beck S, Schonberger T, et al. Intracellular cyclophilin A is an important Ca(2+) regulator in platelets and critically involved in arterial thrombus formation. Blood. 2012;120:1317-26 pubmed publisher
	Eylenstein A, Schmidt S, Gu S, Yang W, Schmid E, Schmidt E, et al. Transcription factor NF-?B regulates expression of pore-forming Ca2+ channel unit, Orai1, and its activator, STIM1, to control Ca2+ entry and affect cellular functions. J Biol Chem. 2012;287:2719-30 pubmed publisher
	Kiviluoto S, Decuypere J, De Smedt H, Missiaen L, Parys J, Bultynck G. STIM1 as a key regulator for Ca2+ homeostasis in skeletal-muscle development and function. Skelet Muscle. 2011;1:16 pubmed publisher
	Saitoh N, Oritani K, Saito K, Yokota T, Ichii M, Sudo T, et al. Identification of functional domains and novel binding partners of STIM proteins. J Cell Biochem. 2011;112:147-56 pubmed publisher
	Pani B, Ong H, Brazer S, Liu X, Rauser K, Singh B, et al. Activation of TRPC1 by STIM1 in ER-PM microdomains involves release of the channel from its scaffold caveolin-1. Proc Natl Acad Sci U S A. 2009;106:20087-92 pubmed publisher
	Beyersdorf N, Braun A, Vögtle T, Varga Szabo D, Galdos R, Kissler S, et al. STIM1-independent T cell development and effector function in vivo. J Immunol. 2009;182:3390-7 pubmed publisher
	Wu F, Wang P, Young L, Lai R, Li L. Proteome-wide identification of novel binding partners to the oncogenic fusion gene protein, NPM-ALK, using tandem affinity purification and mass spectrometry. Am J Pathol. 2009;174:361-70 pubmed publisher
	Braun A, Gessner J, Varga Szabo D, Syed S, Konrad S, Stegner D, et al. STIM1 is essential for Fcgamma receptor activation and autoimmune inflammation. Blood. 2009;113:1097-104 pubmed publisher
	Varga Szabo D, Braun A, Kleinschnitz C, Bender M, Pleines I, Pham M, et al. The calcium sensor STIM1 is an essential mediator of arterial thrombosis and ischemic brain infarction. J Exp Med. 2008;205:1583-91 pubmed publisher
	Pani B, Ong H, Liu X, Rauser K, Ambudkar I, Singh B. Lipid rafts determine clustering of STIM1 in endoplasmic reticulum-plasma membrane junctions and regulation of store-operated Ca2+ entry (SOCE). J Biol Chem. 2008;283:17333-40 pubmed publisher
	Alicia S, Angélica Z, Carlos S, Alfonso S, Vaca L. STIM1 converts TRPC1 from a receptor-operated to a store-operated channel: moving TRPC1 in and out of lipid rafts. Cell Calcium. 2008;44:479-91 pubmed publisher
	Grosse J, Braun A, Varga Szabo D, Beyersdorf N, Schneider B, Zeitlmann L, et al. An EF hand mutation in Stim1 causes premature platelet activation and bleeding in mice. J Clin Invest. 2007;117:3540-50 pubmed

product information

catalog id :

H00006786-M01

product name :

STIM1 monoclonal antibody (M01), clone 5A2

product description :

Mouse monoclonal antibody raised against a full length recombinant STIM1.

clone name :

5A2

isotype :

IgG2a Kappa

gene name :

STIM1

gene alias :

D11S4896E GOK

gene description :

stromal interaction molecule 1

genbank accession :

BC021300

immunogen :

STIM1 (AAH21300, 24 a.a. ~ 685 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

SHSHSEKATGTSSGANSEESTAAEFCRIDKPLCHSEDEK
LSFEAVRNIHKLMDDDANGDVDVEESDEFLREDLNYHDP
TVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVVQW
LITYVELPQYEETFRKLQLSGHAMPRLAVTNTTMTGAVL
KMTDRSHRQKLQLKALDTVLFGPPLLTRHNHLKDFMLVV
SIVIGVGGCWFAYIQNRYSKEHMKKMMKDLEGLHRAEQS
LHDLQERLHKAQEEHRTVEVEKVHLEKKLRDEINLAKQE
AQRLKELREGTENERSRQKYAEEELEQVREALRKAEKEL
ESHSSWYAPEALQKWLQLTHEVEVQYYNIKKQNAEKQLL
VAKEGAEKIKKKRNTLFGTFHVAHSSSLDDVDHKILTAK
QALSEVTAALRERLHRWQQIEILCGFQIVNNPGIHSLVA
ALNIDPSWMGSTRPNPAHFIMTDDVDDMDEEIVSPLSMQ
SPSLQSSVRQRLTEPQHGLGSQRDLTHSDSESSLHMSDR
QRVAPKPPQMSRAADEALNAMTSNGSHRLIEGVHPGSLV
EKLPDSPALAKKALLALNHGLDKAHSLMELSPSAPPGGS
PHLDSSRSHSPSSPDPDTPSPVGDSRALQASRNTRIPHL
AGKKAVAEEDNGSIGEETDSSPGRKKFPLKIFKKPLKK

protein accession :

AAH21300

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human,Rat

application key :

WB-Ti,S-ELISA,ELISA,WB-Re,IF,IHC-P

size :

100 ug

autodate :

10/10/06

updatetime :

11/15/13 18:29

more info or order :

Abnova product webpage