This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
STAT6 monoclonal antibody (M01A), clone 6C10
catalog :
H00006778-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6C10
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00006778-M01A
product name :
STAT6 monoclonal antibody (M01A), clone 6C10
product description :
Mouse monoclonal antibody raised against a partial recombinant STAT6.
clone name :
6C10
isotype :
IgG2b Kappa
gene name :
STAT6
gene alias :
D12S1644 IL-4-STAT STAT6B STAT6C
gene description :
signal transducer and activator of transcription 6, interleukin-4 induced
genbank accession :
BC004973
immunogen :
STAT6 (NP_003144, 694 a.a. ~ 801 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQM
SLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDS
CLSQPVTAFPQGTWIGEDIFPPLLPPTEQD
SLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDS
CLSQPVTAFPQGTWIGEDIFPPLLPPTEQD
protein accession :
NP_003144
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re,WB-Tr
size :
200 uL
autodate :
2008-12-29
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
