product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
STAT2 monoclonal antibody (M01), clone 5G7
catalog :
H00006773-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5G7
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, other
more info or order :
citations: 1
product information
catalog id :
H00006773-M01
product name :
STAT2 monoclonal antibody (M01), clone 5G7
product description :
Mouse monoclonal antibody raised against a partial recombinant STAT2.
clone name :
5G7
isotype :
IgG1 Kappa
gene name :
STAT2
gene alias :
ISGF-3 MGC59816 P113 STAT113
gene description :
signal transducer and activator of transcription 2, 113kDa
genbank accession :
BC051284
immunogen :
STAT2 (AAH51284, 742 a.a. ~ 851 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNG
DPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNG
DPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDF
protein accession :
AAH51284
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- STAT2 monoclonal antibody (M02), clone 2E9 | H00006773-M02
- STAT3 purified MaxPab mouse polyclonal antibody (B01P) | H00006774-B01P
- STAT3 monoclonal antibody (M01), clone 1D11-2A11 | H00006774-M01
- STAT3 monoclonal antibody (M02), clone 4D6 | H00006774-M02
- STAT4 purified MaxPab rabbit polyclonal antibody (D01P) | H00006775-D01P
questions and comments
