SPINK1 monoclonal antibody (M01), clone 4D4 | Abnova H00006690-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

SPINK1 monoclonal antibody (M01), clone 4D4

catalog :

H00006690-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4D4

reactivity :

human

application :

western blot, ELISA, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Abnova product webpage

citations: 11

Published Application/Species/Sample/Dilution	Reference
immunocytochemistry; human; loading ...; fig 1e	Tiwari R, Pandey S, Goel S, Bhatia V, Shukla S, Jing X, et al. SPINK1 promotes colorectal cancer progression by downregulating Metallothioneins expression. Oncogenesis. 2015;4:e162 pubmed publisher
immunohistochemistry; human; 1:50; loading ...; fig 1b	Brooks J, Wei W, Hawley S, AUMAN H, Newcomb L, Boyer H, et al. Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients. PLoS ONE. 2015;10:e0132343 pubmed publisher
western blot; human; 1:250; fig 2.d	Laberge R, Sun Y, Orjalo A, Patil C, Freund A, Zhou L, et al. MTOR regulates the pro-tumorigenic senescence-associated secretory phenotype by promoting IL1A translation. Nat Cell Biol. 2015;17:1049-61 pubmed publisher
immunohistochemistry - paraffin section; human; loading ...; fig 2b	Ateeq B, Kunju L, Carskadon S, Pandey S, Singh G, Pradeep I, et al. Molecular profiling of ETS and non-ETS aberrations in prostate cancer patients from northern India. Prostate. 2015;75:1051-62 pubmed publisher
immunocytochemistry; human	Palanisamy N, Tsodikov A, Yan W, Suleman K, Rittmaster R, Lucia S, et al. Molecular profiling of ETS gene rearrangements in patients with prostate cancer registered in REDEEM clinical trial. Urol Oncol. 2015;33:108.e5-13 pubmed publisher
immunohistochemistry - paraffin section; human; 1:100	Flavin R, Pettersson A, Hendrickson W, Fiorentino M, Finn S, Kunz L, et al. SPINK1 protein expression and prostate cancer progression. Clin Cancer Res. 2014;20:4904-11 pubmed publisher
	Sakata K, Araki K, Nakano H, Nishina T, Komazawa Sakon S, Murai S, et al. Novel method to rescue a lethal phenotype through integration of target gene onto the X-chromosome. Sci Rep. 2016;6:37200 pubmed publisher
	Smith S, Palanisamy N, Zuhlke K, Johnson A, Siddiqui J, Chinnaiyan A, et al. HOXB13 G84E-related familial prostate cancers: a clinical, histologic, and molecular survey. Am J Surg Pathol. 2014;38:615-26 pubmed publisher
	Rink M, Park K, Volkmer B, Xylinas E, Hansen J, Cha E, et al. Loss of SPINK1 expression is associated with unfavorable outcomes in urothelial carcinoma of the bladder after radical cystectomy. Urol Oncol. 2013;31:1716-24 pubmed publisher
	Han B, Mehra R, Suleman K, Tomlins S, Wang L, Singhal N, et al. Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma. Mod Pathol. 2009;22:1176-85 pubmed publisher
	Tomlins S, Rhodes D, Yu J, Varambally S, Mehra R, Perner S, et al. The role of SPINK1 in ETS rearrangement-negative prostate cancers. Cancer Cell. 2008;13:519-28 pubmed publisher

product information

catalog id :

H00006690-M01

product name :

SPINK1 monoclonal antibody (M01), clone 4D4

product description :

Mouse monoclonal antibody raised against a partial recombinant SPINK1.

clone name :

4D4

isotype :

IgG2a Kappa

gene name :

SPINK1

gene alias :

PCTT PSTI Spink3 TATI

gene description :

serine peptidase inhibitor, Kazal type 1

genbank accession :

BC025790

immunogen :

SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCF
ENRKRQTSILIQKSGPC

protein accession :

AAH25790

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human

application key :

S-ELISA,IP,WB-Ti,ELISA,WB-Re,IHC-P

size :

100 ug

autodate :

4/30/08

updatetime :

11/15/13 18:40

more info or order :

Abnova product webpage