This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SMN2 polyclonal antibody (A02)
catalog :
H00006607-A02
quantity :
50 uL
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00006607-A02
product name :
SMN2 polyclonal antibody (A02)
product description :
Mouse polyclonal antibody raised against a full-length recombinant SMN2.
gene name :
SMN2
gene alias :
BCD541 C-BCD541 FLJ76644 MGC20996 MGC5208 SMNC
gene description :
survival of motor neuron 2, centromeric
genbank accession :
BC000908
immunogen :
SMN2 (AAH00908, 1 a.a. ~ 282 a.a) full-length recombinant protein with GST tag.
immunogen sequence protein sequence :
MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTAL
IKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKN
KSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASID
FKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNA
QENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLP
PPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLP
PFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYH
TGYYMEMLA
IKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKN
KSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASID
FKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNA
QENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLP
PPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLP
PFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYH
TGYYMEMLA
protein accession :
AAH00908
storage buffer :
50 % glycerol
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,ELISA,WB-Re
size :
50 uL
autodate :
2010-06-14
updatetime :
2012-02-16 10:09:06
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
