This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SMARCD3 monoclonal antibody (M04), clone 5B6
catalog :
H00006604-M04
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
5B6
reactivity :
human, mouse, rat
application :
western blot, ELISA
product information
catalog id :
H00006604-M04
product name :
SMARCD3 monoclonal antibody (M04), clone 5B6
product description :
Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
clone name :
5B6
isotype :
IgG2a Kappa
gene name :
SMARCD3
gene alias :
BAF60C CRACD3 MGC111010 Rsc6p
gene description :
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
genbank accession :
NM_001003801
immunogen :
SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDL
LRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRY
FYCKIQQRRQELEQSLVVRNT
LRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRY
FYCKIQQRRQELEQSLVVRNT
protein accession :
NP_001003801
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
S-ELISA,ELISA,WB-Re,WB-Ce
size :
100 ug
autodate :
11/22/07
updatetime :
11/15/13 18:37
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
