This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SLC22A2 monoclonal antibody (M02), clone 1E3
catalog :
H00006582-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1E3
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00006582-M02
product name :
SLC22A2 monoclonal antibody (M02), clone 1E3
product description :
Mouse monoclonal antibody raised against a partial recombinant SLC22A2.
clone name :
1E3
isotype :
IgG2a Kappa
gene name :
SLC22A2
gene alias :
MGC32628 OCT2
gene description :
solute carrier family 22 (organic cation transporter), member 2
genbank accession :
BC039899
immunogen :
SLC22A2 (AAH39899, 261 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
HWRWLQFTVALPNFFFLLYYWCIPESPRWLISQNKNAEA
MRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDL
VRTPQIRKHTMILMYNWFTSSVLYQGLIKHMG
MRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDL
VRTPQIRKHTMILMYNWFTSSVLYQGLIKHMG
protein accession :
AAH39899
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2015-04-16
updatetime :
2015-04-16 14:20:14
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
