This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SIAH1 monoclonal antibody (M02), clone 2C5
catalog :
H00006477-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C5
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00006477-M02
product name :
SIAH1 monoclonal antibody (M02), clone 2C5
product description :
Mouse monoclonal antibody raised against a partial recombinant SIAH1.
clone name :
2C5
isotype :
IgG1 Kappa
gene name :
SIAH1
gene alias :
FLJ08065 HUMSIAH Siah-1 Siah-1a hSIAH1
gene description :
seven in absentia homolog 1 (Drosophila)
genbank accession :
NM_003031
immunogen :
SIAH1 (NP_003022, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLF
ECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGP
LGSIRNLAMEKVANSVLFPCKYASSGCEITLP
ECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGP
LGSIRNLAMEKVANSVLFPCKYASSGCEITLP
protein accession :
NP_003022
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2009-10-12
updatetime :
2013-11-15 18:46:22
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
