This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SFRS5 monoclonal antibody (M03A), clone 2C8
catalog :
H00006430-M03A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C8
reactivity :
human
application :
western blot, ELISA
citations: 1
product information
catalog id :
H00006430-M03A
product name :
SFRS5 monoclonal antibody (M03A), clone 2C8
product description :
Mouse monoclonal antibody raised against a full-length recombinant SFRS5.
clone name :
2C8
isotype :
IgM Kappa
gene name :
SFRS5
gene alias :
HRS SRP40
gene description :
splicing factor, arginine/serine-rich 5
genbank accession :
BC018823
immunogen :
SFRS5 (AAH18823.1, 1 a.a. ~ 272 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSGCRVFIGRLNPAAREKGVERFFKGYGRIRDIDLKRGF
GFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRG
GRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSS
RVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGD
LKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTR
SSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSP
VPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
GFVEFEDPRDADDAVYELDGKELCSERVTIEHARARSRG
GRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSS
RVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGD
LKNAIEKLSGKEINGRKIKLIEGSKRHSRSRSRSRSRTR
SSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSP
VPEKSQKRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
protein accession :
AAH18823.1
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,ELISA,WB-Re
size :
200 uL
autodate :
3/2/09
updatetime :
1/13/12 16:44
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
