This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CXCL12 monoclonal antibody (M01), clone 1E5
catalog :
H00006387-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1.00E+05
reactivity :
human
product information
catalog id :
H00006387-M01
product name :
CXCL12 monoclonal antibody (M01), clone 1E5
product description :
Mouse monoclonal antibody raised against a full length recombinant CXCL12.
clone name :
1.00E+05
isotype :
IgG2b Kappa
gene name :
CXCL12
gene alias :
PBSF SCYB12 SDF-1a SDF-1b SDF1 SDF1A SDF1B TLSF-a TLSF-b TPAR1
gene description :
chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1)
genbank accession :
BC039893
immunogen :
CXCL12 (AAH39893.1, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHV
ARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKW
IQEYLEKALNK
ARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKW
IQEYLEKALNK
protein accession :
AAH39893.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
