This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SDCBP monoclonal antibody (M01), clone 2C12
catalog :
H00006386-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2C12
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
citations: 1
product information
catalog id :
H00006386-M01
product name :
SDCBP monoclonal antibody (M01), clone 2C12
product description :
Mouse monoclonal antibody raised against a partial recombinant SDCBP.
clone name :
2C12
isotype :
IgG1 Kappa
gene name :
SDCBP
gene alias :
MDA-9 ST1 SYCL TACIP18
gene description :
syndecan binding protein (syntenin)
genbank accession :
NM_005625
immunogen :
SDCBP (NP_005616, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPI
PHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPL
QGQLVARPSSINYMVAPVTGND
PHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPL
QGQLVARPSSINYMVAPVTGND
protein accession :
NP_005616
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,IP,S-ELISA,ELISA,WB-Re,IF,WB-Ce,IHC-P
size :
100 ug
autodate :
8/4/20
updatetime :
8/4/20 15:46
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
