This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CX3CL1 monoclonal antibody (M01), clone 1D6
catalog :
H00006376-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D6
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00006376-M01
product name :
CX3CL1 monoclonal antibody (M01), clone 1D6
product description :
Mouse monoclonal antibody raised against a partial recombinant CX3CL1.
clone name :
1D6
isotype :
IgG1 Kappa
gene name :
CX3CL1
gene alias :
ABCD-3 C3Xkine CXC3 CXC3C NTN NTT SCYD1 fractalkine neurotactin
gene description :
chemokine (C-X3-C motif) ligand 1
genbank accession :
BC001163
immunogen :
CX3CL1 (AAH01163, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAII
LETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTF
EKQIGEVKPRTTPAAGGMDESVVLEPEATGES
LETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTF
EKQIGEVKPRTTPAAGGMDESVVLEPEATGES
protein accession :
AAH01163
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
