This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CXCL5 monoclonal antibody (M05), clone 2A9
catalog :
H00006374-M05
quantity :
50 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2A9
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
citations: 1
product information
catalog id :
H00006374-M05
product name :
CXCL5 monoclonal antibody (M05), clone 2A9
product description :
Mouse monoclonal antibody raised against a full length recombinant CXCL5.
clone name :
2A9
isotype :
IgG1 Kappa
gene name :
CXCL5
gene alias :
ENA-78 SCYB5
gene description :
chemokine (C-X-C motif) ligand 5
genbank accession :
BC008376
immunogen :
CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGP
AAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKV
EVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
AAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKV
EVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
protein accession :
AAH08376
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IHC-P,ELISA,WB-Re
size :
50 ug
autodate :
2007-11-09
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
