This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
CCL15 monoclonal antibody (M05), clone 3B1
catalog :
H00006359-M05
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3B1
reactivity :
human
product information
catalog id :
H00006359-M05
product name :
CCL15 monoclonal antibody (M05), clone 3B1
product description :
Mouse monoclonal antibody raised against a partial recombinant CCL15.
clone name :
3B1
isotype :
IgG2a Kappa
gene name :
CCL15
gene alias :
HCC-2 HMRP-2B LKN1 Lkn-1 MIP-1d MIP-5 NCC-3 NCC3 SCYA15 SCYL3 SY15
gene description :
chemokine (C-C motif) ligand 15
genbank accession :
NM_032965
immunogen :
CCL15 (NP_116741, 25 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIP
CSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQ
DCMKKLKPYSI
CSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQ
DCMKKLKPYSI
protein accession :
NP_116741
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2006-11-29
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
