This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SAA1 monoclonal antibody (M01), clone 3C11-2C1
catalog :
H00006288-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3C11-2C1
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
catalog id :
H00006288-M01
product name :
SAA1 monoclonal antibody (M01), clone 3C11-2C1
product description :
Mouse monoclonal antibody raised against a full length recombinant SAA1.
clone name :
3C11-2C1
isotype :
IgG2b kappa
gene name :
SAA1
gene alias :
MGC111216 PIG4 SAA TP53I4
gene description :
serum amyloid A1
genbank accession :
BC007022
immunogen :
SAA1 (AAH07022, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAY
SDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISD
ARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAG
LPEKY
SDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISD
ARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAG
LPEKY
protein accession :
AAH07022
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,IHC-P,WB-Ti
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
