This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
S100B monoclonal antibody (M50), clone 1B2
catalog :
H00006285-M50
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B2
reactivity :
human
application :
western blot, ELISA, immunohistochemistry - paraffin section
product information
catalog id :
H00006285-M50
product name :
S100B monoclonal antibody (M50), clone 1B2
product description :
Mouse monoclonal antibody raised against a full-length recombinant S100B.
clone name :
1B2
isotype :
IgG1 Kappa
gene name :
S100B
gene alias :
NEF S100 S100beta
gene description :
S100 calcium binding protein B
genbank accession :
NM_006272.1
immunogen :
S100B (NP_006263.1, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINN
ELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFV
AMVTTACHEFFEHE
ELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFV
AMVTTACHEFFEHE
protein accession :
NP_006263.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Re,ELISA,S-ELISA,IHC-P
size :
100 ug
autodate :
9/24/15
updatetime :
9/24/15 15:12
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
