This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
S100A8 (Human) Recombinant Protein (P01)
catalog :
H00006279-P01
quantity :
25 ug
citations: 3
| Reference |
|---|
Wolf R, Howard O, Dong H, Voscopoulos C, Boeshans K, Winston J, et al. Chemotactic activity of S100A7 (Psoriasin) is mediated by the receptor for advanced glycation end products and potentiates inflammation with highly homologous but functionally distinct S100A15. J Immunol. 2008;181:1499-506 pubmed
|
Venkataraman N, Cole A, Svoboda P, Pohl J, Cole A. Cationic polypeptides are required for anti-HIV-1 activity of human vaginal fluid. J Immunol. 2005;175:7560-7 pubmed
|
product information
catalog id :
H00006279-P01
product name :
S100A8 (Human) Recombinant Protein (P01)
product description :
Human S100A8 full-length ORF ( AAH05928.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.
gene name :
S100A8
gene alias :
60B8AG CAGA CFAG CGLA CP-10 L1Ag MA387 MIF MRP8 NIF P8
gene description :
S100 calcium binding protein A8
genbank accession :
BC005928
immunogen sequence protein sequence :
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLE
TECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
GVAAHKKSHEESHKE
TECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
GVAAHKKSHEESHKE
protein accession :
AAH05928.1
preparation method :
in vitro wheat germ expression system
storage buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
note :
Best use within three months from the date of receipt of this protein.
tag :
GST
type clonality :
Protein
raised in host species :
Wheat Germ (in vitro)
antigen species target species :
Human
application key :
AP,Array,ELISA,WB-Re
size :
25 ug
autodate :
2008-09-01
updatetime :
2013-10-18 19:02:46
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
