This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
S100A8 purified MaxPab mouse polyclonal antibody (B02P)
catalog :
H00006279-B02P
quantity :
50 ug
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00006279-B02P
product name :
S100A8 purified MaxPab mouse polyclonal antibody (B02P)
product description :
Mouse polyclonal antibody raised against a full-length human S100A8 protein.
gene name :
S100A8
gene alias :
60B8AG CAGA CFAG CGLA CP-10 L1Ag MA387 MIF MRP8 NIF P8
gene description :
S100 calcium binding protein A8
genbank accession :
NM_002964.3
immunogen :
S100A8 (NP_002955.2, 1 a.a. ~ 93 a.a) full-length human protein.
immunogen sequence protein sequence :
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLE
TECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
GVAAHKKSHEESHKE
TECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM
GVAAHKKSHEESHKE
protein accession :
NP_002955.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr
size :
50 ug
autodate :
2014-06-26
updatetime :
2014-06-26 15:09:50
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
