This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
RAC2 monoclonal antibody (M04A), clone M1
catalog :
H00005880-M04A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
M1
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005880-M04A
product name :
RAC2 monoclonal antibody (M04A), clone M1
product description :
Mouse monoclonal antibody raised against a full-length recombinant RAC2.
clone name :
M1
isotype :
IgM Kappa
gene name :
RAC2
gene alias :
EN-7 Gx HSPC022
gene description :
ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
genbank accession :
BC001485
immunogen :
RAC2 (AAH01485.1, 1 a.a. ~ 192 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDN
YSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVF
LICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKL
DLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLE
CSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
YSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVF
LICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKL
DLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLE
CSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
protein accession :
AAH01485.1
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2008-08-05
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
