This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
RAB27B purified MaxPab mouse polyclonal antibody (B02P)
catalog :
H00005874-B02P
quantity :
50 ug
clonality :
polyclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
catalog id :
H00005874-B02P
product name :
RAB27B purified MaxPab mouse polyclonal antibody (B02P)
product description :
Mouse polyclonal antibody raised against a full-length human RAB27B protein.
gene name :
RAB27B
gene alias :
-
gene description :
RAB27B, member RAS oncogene family
genbank accession :
EU176518.1
immunogen :
RAB27B (ABW03319.1, 1 a.a. ~ 218 a.a) full-length human protein.
immunogen sequence protein sequence :
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFI
TTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQ
ERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQL
QANAYCENPDIVLIGNKADLPDQREVNERQARELADKYG
IPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIP
DTVNGGNSGNLDGEKPPEKKCIC
TTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQ
ERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQL
QANAYCENPDIVLIGNKADLPDQREVNERQARELADKYG
IPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIP
DTVNGGNSGNLDGEKPPEKKCIC
protein accession :
ABW03319.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr
size :
50 ug
autodate :
2011-11-08
updatetime :
2013-11-15 18:48:17
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
