product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
RAB27A monoclonal antibody (M02), clone 1G7
catalog :
H00005873-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G7
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 5
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
product information
catalog id :
H00005873-M02
product name :
RAB27A monoclonal antibody (M02), clone 1G7
product description :
Mouse monoclonal antibody raised against a partial recombinant RAB27A.
clone name :
1G7
isotype :
IgG1 Kappa
gene name :
RAB27A
gene alias :
GS2 HsT18676 MGC117246 RAB27 RAM
gene description :
RAB27A, member RAS oncogene family
genbank accession :
NM_004580
immunogen :
RAB27A (NP_004571, 122 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYF
ETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVV
RSNGHASTDQLSEEKEKGACGC
ETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVV
RSNGHASTDQLSEEKEKGACGC
protein accession :
NP_004571
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
size :
100 ug
autodate :
2008-04-24
updatetime :
2013-11-15 18:40:03
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- RAB27B purified MaxPab mouse polyclonal antibody (B01P) | H00005874-B01P
- RAB27B purified MaxPab rabbit polyclonal antibody (D01P) | H00005874-D01P
- RABGGTA purified MaxPab mouse polyclonal antibody (B01P) | H00005875-B01P
- RABGGTB monoclonal antibody (M02), clone 1C2 | H00005876-M02
- RABIF monoclonal antibody (M01), clone 2G3 | H00005877-M01
questions and comments
