This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PTH monoclonal antibody (M02), clone 2E4
catalog :
H00005741-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2E4
reactivity :
human
application :
immunoprecipitation
product information
catalog id :
H00005741-M02
product name :
PTH monoclonal antibody (M02), clone 2E4
product description :
Mouse monoclonal antibody raised against a full-length recombinant PTH.
clone name :
2E4
isotype :
IgG2a Kappa
gene name :
PTH
gene alias :
PTH1
gene description :
parathyroid hormone
immunogen :
PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein.
immunogen sequence protein sequence :
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGA
PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVL
TKAKSQ
PLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVL
TKAKSQ
protein accession :
-
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,IP
size :
100 ug
autodate :
2006-12-10
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
