This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PTEN monoclonal antibody (M13), clone 1C3
catalog :
H00005728-M13
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C3
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunoprecipitation
product information
catalog id :
H00005728-M13
product name :
PTEN monoclonal antibody (M13), clone 1C3
product description :
Mouse monoclonal antibody raised against a partial recombinant PTEN.
clone name :
1C3
isotype :
IgG2a Kappa
gene name :
PTEN
gene alias :
10q23del BZS MGC11227 MHAM MMAC1 PTEN1 TEP1
gene description :
phosphatase and tensin homolog
genbank accession :
NM_000314.1
immunogen :
PTEN (NP_000305.1, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAE
RLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTA
KFNCRVAQYPFE
RLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTA
KFNCRVAQYPFE
protein accession :
NP_000305
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,ELISA,WB-Re,IP
size :
100 ug
autodate :
2008-11-10
updatetime :
2014-12-02 15:39:23
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
