This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PSPH monoclonal antibody (M01A), clone 3A5
catalog :
H00005723-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3A5
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005723-M01A
product name :
PSPH monoclonal antibody (M01A), clone 3A5
product description :
Mouse monoclonal antibody raised against a full-length recombinant PSPH.
clone name :
3A5
isotype :
IgG2b Kappa
gene name :
PSPH
gene alias :
PSP
gene description :
phosphoserine phosphatase
genbank accession :
BC063614
immunogen :
PSPH (AAH63614, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICG
VEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQR
LIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVE
HVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESG
GKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIG
FGGNVIRQQVKDNAKWYITDFVELLGELEE
VEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQR
LIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVE
HVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESG
GKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIG
FGGNVIRQQVKDNAKWYITDFVELLGELEE
protein accession :
AAH63614
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ti,ELISA,WB-Re,WB-Tr
size :
200 uL
autodate :
2008-12-15
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
