This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
EIF2AK2 monoclonal antibody (M01A), clone 1B9
catalog :
H00005610-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B9
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005610-M01A
product name :
EIF2AK2 monoclonal antibody (M01A), clone 1B9
product description :
Mouse monoclonal antibody raised against a partial recombinant EIF2AK2.
clone name :
1B9
isotype :
IgG2a Kappa
gene name :
EIF2AK2
gene alias :
EIF2AK1 MGC126524 PKR PRKR
gene description :
eukaryotic translation initiation factor 2-alpha kinase 2
genbank accession :
NM_002759
immunogen :
EIF2AK2 (NP_002750, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDR
RFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKE
KKAVSPLLLTTTNSSEGLSMGN
RFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKE
KKAVSPLLLTTTNSSEGLSMGN
protein accession :
NP_002750
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re,WB-Tr
size :
200 uL
autodate :
2011-03-04
updatetime :
2012-01-05 19:00:38
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
