This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
MAPK9 monoclonal antibody (M05), clone 1D6
catalog :
H00005601-M05
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D6
reactivity :
human, mouse, rat
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00005601-M05
product name :
MAPK9 monoclonal antibody (M05), clone 1D6
product description :
Mouse monoclonal antibody raised against a partial recombinant MAPK9.
clone name :
1D6
isotype :
IgG2a Kappa
gene name :
MAPK9
gene alias :
JNK-55 JNK2 JNK2A JNK2ALPHA JNK2B JNK2BETA PRKM9 SAPK p54a p54aSAPK
gene description :
mitogen-activated protein kinase 9
genbank accession :
BC032539
immunogen :
MAPK9 (AAH32539, 321 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
ITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKE
VMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISS
MSTEQTLASDTDSSLDASTGPLEGCR
protein accession :
AAH32539
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Ce,WB-Ti,IF,ELISA,WB-Re
size :
100 ug
autodate :
2009-02-16
updatetime :
2013-11-15 18:41:54
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098