product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
PRKCA monoclonal antibody (M01A), clone 2F11
catalog :
H00005578-M01A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2F11
reactivity :
human
application :
western blot, ELISA, other
more info or order :
citations: 1
product information
catalog id :
H00005578-M01A
product name :
PRKCA monoclonal antibody (M01A), clone 2F11
product description :
Mouse monoclonal antibody raised against a partial recombinant PRKCA.
clone name :
2F11
isotype :
IgG1 Kappa
gene name :
PRKCA
gene alias :
AAG6 MGC129900 MGC129901 PKC-alpha PKCA PRKACA
gene description :
protein kinase C, alpha
genbank accession :
NM_002737
immunogen :
PRKCA (NP_002728, 563 a.a. ~ 672 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRID
WEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPP
DQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
WEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPP
DQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
protein accession :
NP_002728
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
200 uL
autodate :
2010-09-27
updatetime :
2012-01-13 16:42:47
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- PRKCB1 polyclonal antibody (A01) | H00005579-A01
- PRKCB purified MaxPab rabbit polyclonal antibody (D01P) | H00005579-D01P
- PRKCD purified MaxPab rabbit polyclonal antibody (D01P) | H00005580-D01P
- PRKCD monoclonal antibody (M01), clone 8G2 | H00005580-M01
- PRKCD monoclonal antibody (M02), clone 6A2 | H00005580-M02
questions and comments
