This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PRKAA1 monoclonal antibody (M03), clone 4D8
catalog :
H00005562-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
4D8
reactivity :
human
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
product information
catalog id :
H00005562-M03
product name :
PRKAA1 monoclonal antibody (M03), clone 4D8
product description :
Mouse monoclonal antibody raised against a partial recombinant PRKAA1.
clone name :
4D8
isotype :
IgG2a Kappa
gene name :
PRKAA1
gene alias :
AMPK AMPKa1 MGC33776 MGC57364
gene description :
protein kinase, AMP-activated, alpha 1 catalytic subunit
genbank accession :
NM_006251
immunogen :
PRKAA1 (AAH12622, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVS
NYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTP
RPGSHTIEFFEMCANLIKILAQ
NYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTP
RPGSHTIEFFEMCANLIKILAQ
protein accession :
AAH12622
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IHC-P,IF,ELISA,WB-Re
size :
100 ug
autodate :
2007-07-12
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
