This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PPIA monoclonal antibody (M01J), clone 1F4-1B5
catalog :
H00005478-M01J
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F4-1B5
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005478-M01J
product name :
PPIA monoclonal antibody (M01J), clone 1F4-1B5
product description :
Mouse monoclonal antibody raised against a full-length recombinant PPIA.
clone name :
1F4-1B5
isotype :
IgG2a Kappa
gene name :
PPIA
gene alias :
CYPA CYPH MGC117158 MGC12404 MGC23397
gene description :
peptidylprolyl isomerase A (cyclophilin A)
genbank accession :
BC000689
immunogen :
PPIA (AAH00689.1, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRAL
STGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSI
YGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTA
KTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKI
TIADCGQLE
STGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSI
YGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTA
KTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKI
TIADCGQLE
protein accession :
AAH00689.1
preparation method :
Cell Culture Production. (CX Grade Antibody List)
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Tr,S-ELISA,WB-Ce,WB-Re,ELISA
size :
100 ug
autodate :
11/28/18
updatetime :
12/12/19 14:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
