This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PPARBP monoclonal antibody (M05), clone 2H6
catalog :
H00005469-M05
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2H6
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005469-M05
product name :
PPARBP monoclonal antibody (M05), clone 2H6
product description :
Mouse monoclonal antibody raised against a partial recombinant PPARBP.
clone name :
2H6
isotype :
IgG1 Kappa
gene name :
MED1
gene alias :
CRSP1 CRSP200 DRIP205 DRIP230 MGC71488 PBP PPARBP PPARGBP RB18A TRAP220 TRIP2
gene description :
mediator complex subunit 1
genbank accession :
NM_004774
immunogen :
PPARBP (NP_004765, 1391 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSK
NYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESG
SSIAEKSYQNSPSSDDGIRPLP
NYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESG
SSIAEKSYQNSPSSDDGIRPLP
protein accession :
NP_004765
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2007-02-01
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
