This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PLP1 monoclonal antibody (M03), clone 2D7
catalog :
H00005354-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2D7
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00005354-M03
product name :
PLP1 monoclonal antibody (M03), clone 2D7
product description :
Mouse monoclonal antibody raised against a partial recombinant PLP1.
clone name :
2D7
isotype :
IgG2a Kappa
gene name :
PLP1
gene alias :
HLD1 MMPL PLP PLP/DM20 PMD SPG2
gene description :
proteolipid protein 1
genbank accession :
NM_000533
immunogen :
PLP1 (NP_000524, 177 a.a. ~ 232 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAF
PGKVCGSNLLSICKTAE
PGKVCGSNLLSICKTAE
protein accession :
NP_000524
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
5/8/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
