This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PLGLB2 monoclonal antibody (M04A), clone 3E6
catalog :
H00005342-M04A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3E6
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00005342-M04A
product name :
PLGLB2 monoclonal antibody (M04A), clone 3E6
product description :
Mouse monoclonal antibody raised against a partial recombinant PLGLB2.
clone name :
3E6
isotype :
IgG1 Kappa
gene name :
PLGLB2
gene alias :
PLGP1
gene description :
plasminogen-like B2
genbank accession :
NM_002665
immunogen :
PLGLB2 (NP_002656, 21 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEF
TCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
TCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
protein accession :
NP_002656
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
ELISA,WB-Re
size :
200 uL
autodate :
2008-12-15
updatetime :
2012-01-13 16:44:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
