This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PLA2G2A monoclonal antibody (M01), clone 2E8
catalog :
H00005320-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2E8
reactivity :
human
product information
catalog id :
H00005320-M01
product name :
PLA2G2A monoclonal antibody (M01), clone 2E8
product description :
Mouse monoclonal antibody raised against a full-length recombinant PLA2G2A.
clone name :
2E8
isotype :
IgG1 Kappa
gene name :
PLA2G2A
gene alias :
MOM1 PLA2 PLA2B PLA2L PLA2S PLAS1 sPLA2
gene description :
phospholipase A2, group IIA (platelets, synovial fluid)
genbank accession :
BC005919.1
immunogen :
PLA2G2A (AAH05919.1, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MKTLLLLAVIMIFGLLQAHGNLVNFHRMIKLTTGKEAAL
SYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRG
CGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATC
SARNKTTYNKKYQYYSNKHCRGSTPRC
SYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRG
CGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATC
SARNKTTYNKKYQYYSNKHCRGSTPRC
protein accession :
AAH05919.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2015-01-29
updatetime :
2015-01-29 11:09:15
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
