This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PITX2 monoclonal antibody (M01), clone 2G6
catalog :
H00005308-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2G6
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
citations: 2
| Reference |
|---|
product information
catalog id :
H00005308-M01
product name :
PITX2 monoclonal antibody (M01), clone 2G6
product description :
Mouse monoclonal antibody raised against a full length recombinant PITX2.
clone name :
2G6
isotype :
IgG2a Kappa
gene name :
PITX2
gene alias :
ARP1 Brx1 IDG2 IGDS IGDS2 IHG2 IRID2 MGC111022 MGC20144 Otlx2 PTX2 RGS RIEG RIEG1 RS
gene description :
paired-like homeodomain 2
genbank accession :
BC013998
immunogen :
PITX2 (AAH13998, 1 a.a. ~ 324 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVL
APGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKN
EDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYP
DMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQA
ELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSAS
LSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMV
PSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAP
PTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASN
LSACQYAVDRPV
APGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKN
EDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYP
DMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQA
ELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSAS
LSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMV
PSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAP
PTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASN
LSACQYAVDRPV
protein accession :
AAH13998
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
