This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
protein
product name :
ABCB1 (Human) Recombinant Protein (Q01)
catalog :
H00005243-Q01
quantity :
10 ug,25 ug
citations: 1
| Reference |
|---|
Kamiie J, Ohtsuki S, Iwase R, Ohmine K, Katsukura Y, Yanai K, et al. Quantitative atlas of membrane transporter proteins: development and application of a highly sensitive simultaneous LC/MS/MS method combined with novel in-silico peptide selection criteria. Pharm Res. 2008;25:1469-83 pubmed publisher
|
product information
catalog id :
H00005243-Q01
product name :
ABCB1 (Human) Recombinant Protein (Q01)
product description :
Human ABCB1 partial ORF ( NP_000918, 620 a.a. - 709 a.a.) recombinant protein with GST-tag at N-terminal.
gene name :
ABCB1
gene alias :
ABC20 CD243 CLCS GP170 MDR1 MGC163296 P-GP PGY1
gene description :
ATP-binding cassette, sub-family B (MDR/TAP), member 1
genbank accession :
NM_000927
immunogen sequence protein sequence :
GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDS
RSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSF
WRIMKLNLTEWP
RSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSF
WRIMKLNLTEWP
protein accession :
NP_000918
preparation method :
in vitro wheat germ expression system
storage buffer :
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
storage instruction :
Store at -80 C. Aliquot to avoid repeated freezing and thawing.
quality control testing :
12.5% SDS-PAGE Stained with Coomassie Blue.
note :
Best use within three months from the date of receipt of this protein.
tag :
GST
type clonality :
Protein
raised in host species :
Wheat Germ (in vitro)
antigen species target species :
Human
application key :
AP,WB-Re,ELISA,Array
size :
10 ug,25 ug
autodate :
10/10/06
updatetime :
10/18/13 18:52
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
