This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
PDK1 monoclonal antibody (M02), clone 3E1
catalog :
H00005163-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3E1
reactivity :
human
product information
catalog id :
H00005163-M02
product name :
PDK1 monoclonal antibody (M02), clone 3E1
product description :
Mouse monoclonal antibody raised against a partial recombinant PDK1.
clone name :
3E1
isotype :
IgG1 Kappa
gene name :
PDK1
gene alias :
-
gene description :
pyruvate dehydrogenase kinase, isozyme 1
genbank accession :
BC039158
immunogen :
PDK1 (AAH39158, 203 a.a. ~ 302 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCD
LYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQ
LYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL
FKNAMRATMEHHANRGVYPPIQ
protein accession :
AAH39158
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
2006-10-25
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
